PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast07G005400.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family TALE
Protein Properties Length: 446aa    MW: 48698 Da    PI: 8.0149
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast07G005400.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.79.4e-092552921954
                         HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
            Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                         Fe   ++yp+  ++  LA+++gL+ +qV++WF N R +
  Brast07G005400.2.p 255 FEHflHPYPNDVDKHILARQTGLSRSQVSNWFINARVR 292
                         5544589*****************************88 PP

2BELL94.41e-30114182472
                BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                         +lq++ka Lls+++eVd+rY++y+eq+++   sF+a+ag g+a++Yt+lA++a+SrhFr+L+da+++q+
  Brast07G005400.2.p 114 ALQRRKATLLSMVQEVDRRYRRYREQMRATELSFDAAAGAGAAQVYTRLAMRAMSRHFRSLRDALVGQV 182
                         69****************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.9E-4147180IPR006563POX domain
PfamPF075263.2E-3756178IPR006563POX domain
PROSITE profilePS5007111.758233296IPR001356Homeobox domain
SMARTSM003898.2E-9236300IPR001356Homeobox domain
CDDcd000866.90E-12236297No hitNo description
SuperFamilySSF466892.65E-17237303IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-27239302IPR009057Homeodomain-like
PfamPF059202.0E-17253292IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 446 aa     Download sequence    Send to blast
MTHHHHLLDF SSSSSSPPAP FHHAETTPWP APTHVPPYYT APPTTTMPAM TQPLLLNSSR  60
YLGPARELLA ELCSLTDHAA WNPKGGGVDV EANYSASWEG SNPGALLSSM DLLALQRRKA  120
TLLSMVQEVD RRYRRYREQM RATELSFDAA AGAGAAQVYT RLAMRAMSRH FRSLRDALVG  180
QVTKAMGQGD TTGSLLAVVP GASRGDTPRL RVLAQCLRQQ RALFQKSGCA SESYPWRPQR  240
GLPERAVAVL RSWLFEHFLH PYPNDVDKHI LARQTGLSRS QVSNWFINAR VRLWKPMIEE  300
MYAEEETKQP GAIANGRGGG KPVVVIDDHH GNYTAAAWST TGEISPHHRL DSCGRDPSSC  360
FVPAASIVPA DDHGQQLLFH SYLSSNNGGG GGAAAVSLTL GLQQRQRQPA MMLGEAGEEE  420
DVVLPYRNLM GSELLHGLAD PAVYN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_B2e-15242300563Homeobox protein Meis2
4xrm_A2e-15242300563Homeobox protein Meis2
5bng_A2e-15242300159Homeobox protein Meis2
5bng_B2e-15242300159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003557261.10.0PREDICTED: homeobox protein BEL1 homolog
TrEMBLI1H1Z10.0I1H1Z1_BRADI; Uncharacterized protein
STRINGBRADI1G51980.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.13e-79TALE family protein